PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F02725.1.p
Common NameEUGRSUZ_F02725
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 332aa    MW: 35832.5 Da    PI: 6.5905
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F02725.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.52.5e-3793148661
            zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                        +cprC s++tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn+++
  Eucgr.F02725.1.p  93 PSCPRCASSHTKFCYYNNYSLSQPRYFCKSCRRYWTKGGSLRNVPVGGGCRKNRRT 148
                       68***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088428.60293147IPR003851Zinc finger, Dof-type
PfamPF027011.2E-3193147IPR003851Zinc finger, Dof-type
PROSITE patternPS01361095131IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-21102147IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MKYRKHKTHD HESSSSSPPS PSNDFTPPSS SLVLTAHQPP TRLTLKREPR SSLSSLLVTG  60
CEKNTMFAPS SDQAALFQRW GTSSHGGVPA AAPSCPRCAS SHTKFCYYNN YSLSQPRYFC  120
KSCRRYWTKG GSLRNVPVGG GCRKNRRTRP SSRSQAPASG QPERASLAGG QPDSVDKDQS  180
VESPQSGSPA TAAGALDIDM VAVFAKFLNN EQTKSCSQEL TGSTSSAVTP DSVQTAASLD  240
LVEEQAEPPP EVPHAEGLFT ETNGFDHQES SADDLLWVDT TSCLANFAWQ PMVQLQEIGT  300
PPADDHFRLL PTNDNFWSSF DLAGFELSSR P*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F02725.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN3937195e-45JN393719.1 Sorghum bicolor clone Sbdof25 Dof (Dof) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010064809.10.0PREDICTED: dof zinc finger protein DOF1.2
TrEMBLA0A059BT940.0A0A059BT94_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64622643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.15e-31Dof family protein